>pdb|1BU7|A Chain A, Cryogenic Structure Of Cytochrome P450bm-3 Heme Domain pdb|1BU7|B Chain B, Cryogenic Structure Of Cytochrome P450bm-3 Heme Domain pdb|2BMH|A Chain A, Cytochrome P450 (Bm-3) (E.C.1.14.14.1) (Hemoprotein Domain) pdb|2BMH|B Chain B, Cytochrome P450 (Bm-3) (E.C.1.14.14.1) (Hemoprotein Domain) Length = 455 Score = 26.6 bits (57), Expect = 0.51 Identities = 15/42 (35%), Positives = 25/42 (58%) Query: 10 SGFLAFLLYALLLYGLLLERHNKEAEKILLDLGKKNEQVIDL 51 SG L+F LY L+ +L++ +EA ++L+D +QV L Sbjct: 270 SGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQL 311