>pdb|1HNZ|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1HNW|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1HNX|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1EMW|A Chain A, Solution Structure Of The Ribosomal Protein S16 From Thermus Thermophilus pdb|1FJG|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin And Paromomycin pdb|1J5E|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit pdb|1IBL|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1HR0|P Chain P, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1IBM|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBK|P Chain P, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1I94|P Chain P, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 pdb|1I96|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) pdb|1I97|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline pdb|1I95|P Chain P, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine Length = 88 Score = 78.2 bits (191), Expect = 2e-16 Identities = 36/77 (46%), Positives = 50/77 (64%), Gaps = 1/77 (1%) Query: 1 MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSEPKD-IKIDKERLNYWK 59 M IRL R G K P YR+VVTD+R++RDG +IE I YY+P D +K+D ER YW Sbjct: 1 MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIEYYDPRKTTPDWLKVDVERARYWL 60 Query: 60 GVGAKMSERVEKLSQKA 76 VGA+ ++ +L ++A Sbjct: 61 SVGAQPTDTARRLLRQA 77