>pdb|1MJ1|O Chain O, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND BOSOMAL Proteins Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome pdb|1FJG|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin And Paromomycin pdb|1J5E|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit pdb|1IBL|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1HR0|L Chain L, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1HNZ|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1IBM|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBK|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1HNW|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1HNX|L Chain L, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1JGQ|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1GIX|O Chain O, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGO|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGP|O Chain O, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy Length = 135 Score = 190 bits (483), Expect = 4e-50 Identities = 96/129 (74%), Positives = 105/129 (80%) Query: 1 MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSK 60 +PTINQL+RK R+KV KK+K PAL P RRGVCT V T TPKKPNSALRKVAKVRLTS Sbjct: 4 LPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG 63 Query: 61 FEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTK 120 +EV +YIPGEGHNLQEHS+VL+RGGRVKDLPGV+YHIVRG D AGV R SRSKYGTK Sbjct: 64 YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTK 123 Query: 121 KAKATDKKA 129 K K K A Sbjct: 124 KPKEAAKTA 132