>pdb|1I94|R Chain R, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 pdb|1I96|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) pdb|1I97|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline pdb|1I95|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine Length = 87 Score = 50.8 bits (120), Expect = 3e-08 Identities = 28/69 (40%), Positives = 41/69 (58%) Query: 2 ERKRYSKRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKR 61 +R+ K K T + DY+++++LK LSE KI+PRR TG S K Q + IKR Sbjct: 12 QRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKR 71 Query: 62 ARHMALIPY 70 AR + L+P+ Sbjct: 72 ARILGLLPF 80