>pdb|1L2J|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol pdb|1L2J|B Chain B, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol Length = 271 Score = 28.1 bits (61), Expect = 0.36 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 5/66 (7%) Query: 46 EKLKLAPYECGP--VALKQPNRVSHHFYIMAMLFILFDVEIVFMFPWA---IGFKKLGLF 100 E+L L E P V + +P+ +M L L D E+V M WA GF +L LF Sbjct: 32 EQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLF 91 Query: 101 GLVEML 106 V +L Sbjct: 92 DQVRLL 97