>pdb|1JB7|B Chain B, Dna G-Quartets In A 1.86 A Resolution Structure Of An Oxytricha Nova Telomeric Protein-Dna Complex pdb|1OTC|B Chain B, The O. Nova Telomere End Binding Protein Complexed With Single Strand Dna Length = 260 Score = 23.1 bits (48), Expect = 5.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Query: 28 NEVAIFMFEVGDFSNIPKSAEFIQSKGHELLN 59 +E + F F+ G+ + + + F+Q KG + LN Sbjct: 198 DEFSDFSFKEGNTATLKIADIFVQEKGKDALN 229