>pdb|1J7N|B Chain B, Anthrax Toxin Lethal Factor pdb|1J7N|A Chain A, Anthrax Toxin Lethal Factor pdb|1JKY|A Chain A, Crystal Structure Of The Anthrax Lethal Factor (Lf): Wild- Type Lf Complexed With The N-Terminal Sequence Of Mapkk2 Length = 776 Score = 26.9 bits (58), Expect = 0.37 Identities = 13/31 (41%), Positives = 17/31 (53%) Query: 49 EGYKQAAEGYKKALEAKEKMDKIVNTLKAIN 79 E Y A EGY+ L + D + NT KA+N Sbjct: 116 EHYVYAKEGYEPVLVIQSSEDYVENTEKALN 146