>pdb|1FJG|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotics Streptomycin,
           Spectinomycin And Paromomycin
 pdb|1J5E|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit
 pdb|1IBL|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site And With The Antibiotic Paromomycin
 pdb|1HR0|K Chain K, Crystal Structure Of Initiation Factor If1 Bound To The
           30s Ribosomal Subunit
 pdb|1HNZ|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Hygromycin B
 pdb|1IBM|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site
 pdb|1IBK|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotic Paromomycin
 pdb|1HNW|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Tetracycline
 pdb|1HNX|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Pactamycin
 pdb|1JGQ|N Chain N, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1GIX|N Chain N, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1gix, Contains The 30s Ribosome Subunit,
           Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
           In The File 1giy
 pdb|1JGO|N Chain N, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1JGP|N Chain N, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
          Length = 129

 Score =  126 bits (316), Expect = 9e-31
 Identities = 66/130 (50%), Positives = 90/130 (68%), Gaps = 4/130 (3%)

Query: 1   MAKRNVTAKKKVVKKNIARGVVYISATFNNTNITITDEMGNVICWSTAGGLGFKGSKKST 60
           MAK+     KK VK+ +A G  YI A++NNT +TITD  GN I WS+ G +G+KGS+K T
Sbjct: 1   MAKK---PSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGT 57

Query: 61  PYAAQQAVESALSKAKEHGVKEVGIKVQGPGSGRETAIKSVGATEGIKVLWIKDITPLPH 120
           PYAAQ A   A  KA  +G++ V + V+G G+GRE AI+++ A+ G++V  I D TP+PH
Sbjct: 58  PYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQAS-GLQVKSIVDDTPVPH 116

Query: 121 NGCRPPKRRR 130
           NGCRP K+ R
Sbjct: 117 NGCRPKKKFR 126