>pdb|1EG0|E Chain E, Fitting Of Components With Known Structure Into An 11.5 A Cryo-Em Map Of The E.Coli 70s Ribosome pdb|1FJG|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin And Paromomycin pdb|1IBL|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site And With The Antibiotic Paromomycin pdb|1HR0|H Chain H, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit pdb|1HNZ|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Hygromycin B pdb|1IBM|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With A Messenger Rna Fragment And Cognate Transfer Rna Anticodon Stem-Loop Bound At The A Site pdb|1IBK|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotic Paromomycin pdb|1HNW|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Tetracycline pdb|1HNX|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With Pactamycin pdb|1FKA|H Chain H, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution pdb|1JGQ|K Chain K, The Path Of Messenger Rna Through The Ribosome. This File, 1jgq, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1GIX|K Chain K, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1gix, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGO|K Chain K, The Path Of Messenger Rna Through The Ribosome. This File, 1jgo, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1JGP|K Chain K, The Path Of Messenger Rna Through The Ribosome. This File, 1jgp, Contains The 30s Ribosome Subunit, Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy pdb|1J5E|H Chain H, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Length = 138 Score = 103 bits (257), Expect = 6e-24 Identities = 56/138 (40%), Positives = 80/138 (57%), Gaps = 7/138 (5%) Query: 1 MVNDIIADSLTRLRNASMRRLEFTQLYYAKIVVSILEIFKEKGFIKDFNVKDKDKKQSVY 60 M+ D IAD LTR+RNA+ E T + ++ IL I +GFIK + D D K + Sbjct: 1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLR 60 Query: 61 VQLAY-------DEKGHSKISEVKRLSKPGRRVYKQKNELKRFKNGYGVIVVSTSKGVIT 113 V L Y D + I ++R+SKPGRRVY E+ R + G G+ ++STSKGV+T Sbjct: 61 VYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLT 120 Query: 114 NEEAYRQNVGGEVLCSIW 131 + EA + VGGE++C +W Sbjct: 121 DREARKLGVGGELICEVW 138