>pdb|1FJG|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotics Streptomycin,
          Spectinomycin And Paromomycin
 pdb|1IBL|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site And With The Antibiotic Paromomycin
 pdb|1HR0|N Chain N, Crystal Structure Of Initiation Factor If1 Bound To The
          30s Ribosomal Subunit
 pdb|1HNZ|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Hygromycin B
 pdb|1IBM|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site
 pdb|1IBK|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotic Paromomycin
 pdb|1HNW|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Tetracycline
 pdb|1HNX|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Pactamycin
 pdb|1JGQ|Q Chain Q, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgq, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 pdb|1GIX|Q Chain Q, Crystal Structure Of The Ribosome At 5.5 A Resolution.
          This File, 1gix, Contains The 30s Ribosome Subunit,
          Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
          In The File 1giy
 pdb|1JGO|Q Chain Q, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgo, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 pdb|1JGP|Q Chain Q, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgp, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
          Length = 61

 Score = 92.0 bits (227), Expect = 1e-20
 Identities = 40/61 (65%), Positives = 51/61 (83%)

Query: 1  MAKKSMIAKAQRKPKFQVRAYTRCRICGRPHSVYRDFGLCRVCLRKMGSEGLIPGLRKAS 60
          MA+K++I KA+R PKF+VRAYTRC  CGR  SVYR FGLCR+CLR++  +G +PG+RKAS
Sbjct: 1  MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS 60

Query: 61 W 61
          W
Sbjct: 61 W 61