>pdb|1HXM|B Chain B, Crystal Structure Of A Human Vgamma9VDELTA2 T CELL RECEPTOR pdb|1HXM|D Chain D, Crystal Structure Of A Human Vgamma9VDELTA2 T CELL RECEPTOR pdb|1HXM|F Chain F, Crystal Structure Of A Human Vgamma9VDELTA2 T CELL RECEPTOR pdb|1HXM|H Chain H, Crystal Structure Of A Human Vgamma9VDELTA2 T CELL RECEPTOR Length = 242 Score = 34.3 bits (77), Expect = 0.023 Identities = 18/70 (25%), Positives = 33/70 (46%), Gaps = 1/70 (1%) Query: 181 LKKDIKPLALNAMPFLGTLETYKESQEICFVEKSYIDTLKKHVEVEKEGVVKNLQ-GEVI 239 L D+ P +P + + K +C +EK + D +K H E +K + Q G + Sbjct: 126 LDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWEEKKSNTILGSQEGNTM 185 Query: 240 GTHKGYMQYT 249 T+ YM+++ Sbjct: 186 KTNDTYMKFS 195