>pdb|1KW2|A Chain A, Crystal Structure Of Uncomplexed Vitamin D-Binding Protein pdb|1KW2|B Chain B, Crystal Structure Of Uncomplexed Vitamin D-Binding Protein pdb|1KXP|D Chain D, Crystal Structure Of Human Vitamin D-Binding Protein In Complex With Skeletal Actin Length = 458 Score = 28.9 bits (63), Expect = 0.21 Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 97 GDKKSNLDNFIKVVDLLQTNNLKQLYILVEDKKN 130 G+KKS L N IK+ + T +L+ + L ED N Sbjct: 211 GEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITN 244