>pdb|1DKZ|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Native Crystals pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals pdb|1DKY|B Chain B, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 Score = 26.2 bits (56), Expect = 2.2 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 43 SSLNTALP-EDKTAIEAKEQEQKEKRKRWYELFKKK 77 ++L TAL EDK AIEAK QE + ++ E+ +++ Sbjct: 182 TALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQ 217