>pdb|3TMK|A Chain A, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|B Chain B, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|F Chain F, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|E Chain E, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|G Chain G, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|D Chain D, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|H Chain H, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|3TMK|C Chain C, Crystal Structure Of Yeast Thymidylate Kinase Complexed
           With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
           Implications For Catalysis And Azt Activation
 pdb|1TMK|A Chain A, Yeast Thymidylate Kinase Complexed With Thymidine
           Monophosphate (Dtmp)
 pdb|1TMK|B Chain B, Yeast Thymidylate Kinase Complexed With Thymidine
           Monophosphate (Dtmp)
 pdb|2TMK|A Chain A, Yeast Thymidylate Kinase Complexed With
           3'-Azido-3'-Deoxythymidine Monophosphate (Azt-Mp)
 pdb|2TMK|B Chain B, Yeast Thymidylate Kinase Complexed With
           3'-Azido-3'-Deoxythymidine Monophosphate (Azt-Mp)
          Length = 216

 Score = 26.6 bits (57), Expect = 4.4
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 100 LITLEPCNSYGKTPACSELLEILKPKRVVIATEENEAKKGGL 141
           LI +E  +  GKT  C+ L + L+P   ++   E   + GGL
Sbjct: 7   LILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGL 48