>pdb|3TMK|A Chain A, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|B Chain B, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|F Chain F, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|E Chain E, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|G Chain G, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|D Chain D, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|H Chain H, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|3TMK|C Chain C, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A Resolution:
Implications For Catalysis And Azt Activation
pdb|1TMK|A Chain A, Yeast Thymidylate Kinase Complexed With Thymidine
Monophosphate (Dtmp)
pdb|1TMK|B Chain B, Yeast Thymidylate Kinase Complexed With Thymidine
Monophosphate (Dtmp)
pdb|2TMK|A Chain A, Yeast Thymidylate Kinase Complexed With
3'-Azido-3'-Deoxythymidine Monophosphate (Azt-Mp)
pdb|2TMK|B Chain B, Yeast Thymidylate Kinase Complexed With
3'-Azido-3'-Deoxythymidine Monophosphate (Azt-Mp)
Length = 216
Score = 26.6 bits (57), Expect = 4.4
Identities = 14/42 (33%), Positives = 22/42 (52%)
Query: 100 LITLEPCNSYGKTPACSELLEILKPKRVVIATEENEAKKGGL 141
LI +E + GKT C+ L + L+P ++ E + GGL
Sbjct: 7 LILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGL 48