>pdb|2BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To 9 Base Pairs Of Duplex Dna pdb|3BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To Duplex Dna After The Incorporation Of +ttp By The Enzyme pdb|4BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To 11 Base Pairs Of Duplex Dna After Addition Of Two Datp Residues Length = 580 Score = 24.3 bits (51), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 148 TKDDYIVKPDVLRAIKKYHKIAFKSVYWQQ 177 TK Y DVL + YH+I ++++Q Sbjct: 254 TKTGYSTSADVLEKLAPYHEIVENILHYRQ 283