>pdb|1YTB|A Chain A, Tata-Box Binding Protein (Ytbp) Complexed With Dna Containing Tata-Box pdb|1YTB|B Chain B, Tata-Box Binding Protein (Ytbp) Complexed With Dna Containing Tata-Box pdb|1YTF|A Chain A, Yeast TfiiaTBPDNA COMPLEX pdb|1TBA|B Chain B, Solution Structure Of A Tbp-Tafii230 Complex: Protein Mimicry Of The Minor Groove Surface Of The Tata Box Unwound By Tbp, Nmr, 25 Structures Length = 180 Score = 29.6 bits (65), Expect = 0.36 Identities = 16/50 (32%), Positives = 24/50 (48%) Query: 61 NIVGYCQTLLPQSLNDYSHSQGFFAGVFAWVFKALVYFLIFWIVILLSLV 110 NIVG C P L + S G F+ +F L+Y ++ ++LL V Sbjct: 99 NIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFV 148