>pdb|1K8A|G Chain G, Co-Crystal Structure Of Carbomycin A Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1K9M|G Chain G, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1KD1|G Chain G, Co-Crystal Structure Of Spiramycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1M1K|G Chain G, Co-Crystal Structure Of Azithromycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1M90|G Chain G, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And Sparsomycin Bound To The 50s Ribosomal Subunit pdb|1JJ2|E Chain E, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution pdb|1KQS|E Chain E, The Haloarcula Marismortui 50s Complexed With A Pretranslocational Intermediate In Protein Synthesis pdb|1FFK|1 Chain 1, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 177 Score = 25.8 bits (55), Expect = 3.6 Identities = 13/49 (26%), Positives = 25/49 (50%) Query: 110 INGELDRVKRALWVHFGEYSVLPDIILYQTNKDNIKILAILSVKNSFRE 158 + G+ V R LW + SV D ++ ++++DN K ++ + S E Sbjct: 22 VEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIE 70