>pdb|1LXM|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Hexasaccharide Unit Of Hyaluronan pdb|1I8Q|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan pdb|1F1S|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution Length = 814 Score = 27.3 bits (59), Expect = 1.0 Identities = 16/60 (26%), Positives = 26/60 (42%), Gaps = 7/60 (11%) Query: 114 DQQSVVVSGKTPSKEAFYFLFQNKLNPMFDYSRAEFFPLSDGWFNFVSTNFSNSLLIKNP 173 D +SV + K P + Y F+N D R E G +N ++ N+ ++ NP Sbjct: 654 DTKSVFLESKEPGRNIGYIFFKNS---TIDIERKE----QTGTWNSINRTSKNTSIVSNP 706