>pdb|1LD7|A Chain A, Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate And Inhibitor Compound 66 pdb|1LD8|A Chain A, Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate And Inhibitor Compound 49 pdb|1JCQ|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And The Peptidomimetic Inhibitor L-739,750 Length = 382 Score = 24.3 bits (51), Expect = 2.4 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 8/57 (14%) Query: 43 KALTSSIHRDGEGVCGVYP-----YDIARHRAA---WVRDKAKALEFPLKLLVEEIK 91 K+L +H + + + Y + HR W+RD ++ LEF +L ++ K Sbjct: 142 KSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAK 198