>pdb|2BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To 9 Base Pairs Of Duplex Dna pdb|3BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To Duplex Dna After The Incorporation Of +ttp By The Enzyme pdb|4BDP|A Chain A, Crystal Structure Of Bacillus Dna Polymerase I Fragment Complexed To 11 Base Pairs Of Duplex Dna After Addition Of Two Datp Residues Length = 580 Score = 28.9 bits (63), Expect = 1.0 Identities = 31/134 (23%), Positives = 57/134 (42%), Gaps = 12/134 (8%) Query: 198 IKQELVPGLCLFFQGSLEFNDKTTKTMRTSLLDQIQQDDKSYLKIWEKYLIKSAQKSFNE 257 + + LV ++ F D+ + + LL +++Q S L E +K K + Sbjct: 147 LAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQ 206 Query: 258 -----AKEVGVLEIESVSKEGGNLRIRFKPALG-----KNKMEILKKSQFKKGSDLGVLE 307 A+++G +E G I LG K ++ +LKK++ + VLE Sbjct: 207 MGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLE 266 Query: 308 DLDPQNE--ENLIN 319 L P +E EN+++ Sbjct: 267 KLAPYHEIVENILH 280