>pdb|1GKI|A Chain A, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|B Chain B, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|D Chain D, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|E Chain E, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|F Chain F, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|G Chain G, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GL7|A Chain A, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|B Chain B, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|D Chain D, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|E Chain E, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|F Chain F, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|G Chain G, Plasmid Coupling Protein Trwb In Complex With The
Non-Hydrolisable Atp-Analogue Adpnp.
pdb|1E9S|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|L Chain L, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|M Chain M, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|H Chain H, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|I Chain I, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|J Chain J, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9R|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9S|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|K Chain K, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9R|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9S|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9R|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate
Length = 437
Score = 29.6 bits (65), Expect = 1.4
Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%)
Query: 652 YIFIDEAKSVIENPIMLAKIKDTLAQARKLNGVLTLAFQDINQLDGVEGAK 702
++FIDE S+ + LA + D L + RK + Q +QLD V G K
Sbjct: 282 WLFIDELASLEK----LASLADALTKGRKAGLRVVAGLQSTSQLDDVYGVK 328