>pdb|1KHZ|A Chain A, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg pdb|1KHZ|B Chain B, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg pdb|1G9Q|A Chain A, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose pdb|1GA7|A Chain A, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 pdb|1G0S|B Chain B, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase pdb|1G9Q|B Chain B, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose pdb|1GA7|B Chain B, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 pdb|1G0S|A Chain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase Length = 209 Score = 36.2 bits (82), Expect = 0.003 Identities = 39/161 (24%), Positives = 74/161 (45%), Gaps = 19/161 (11%) Query: 56 AVLL-YEKESDCFVIVKQFRPAIYARRFHFKCDQDQTIDGYTYELCAGLVDKANKSLEEI 114 AVLL ++ D V+++Q R A Y D + + E+ AG++++ +S+E++ Sbjct: 60 AVLLPFDPVRDEVVLIEQIRIAAY----------DTSETPWLLEMVAGMIEEG-ESVEDV 108 Query: 115 ACEEALEECGYQISPKNLETIGQFYSATGLSGSLQTLYYAEVHKNLKVSKGGGID-TERI 173 A EA+EE G + K + + F ++ G + ++ EV G D E I Sbjct: 109 ARREAIEEAGLIV--KRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLADENEDI 166 Query: 174 EVLFLERSKALDFIMDFQYAKTTGLSLAILW---HLKKFKN 211 V + R +A ++ + + + +A+ W H + KN Sbjct: 167 RVHVVSREQAYQWVEEGKIDNAASV-IALQWLQLHHQALKN 206