>pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome Length = 678 Score = 26.2 bits (56), Expect = 2.5 Identities = 13/31 (41%), Positives = 16/31 (50%) Query: 59 GFQVGFVLKKKALLGGYLDAGMGDSYFMSAG 89 G V V+ K A +G +L M D YFM G Sbjct: 277 GSAVASVVSKAAKMGDFLRNDMFDKYFMKIG 307