>pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
          Length = 678

 Score = 26.2 bits (56), Expect = 2.5
 Identities = 13/31 (41%), Positives = 16/31 (50%)

Query: 59  GFQVGFVLKKKALLGGYLDAGMGDSYFMSAG 89
           G  V  V+ K A +G +L   M D YFM  G
Sbjct: 277 GSAVASVVSKAAKMGDFLRNDMFDKYFMKIG 307