>pdb|2FIV|A Chain A, Crystal Structure Of Feline Immunodeficiency Virus Protease Complexed With A Substrate pdb|2FIV|B Chain B, Crystal Structure Of Feline Immunodeficiency Virus Protease Complexed With A Substrate Length = 116 Score = 25.8 bits (55), Expect = 1.9 Identities = 14/37 (37%), Positives = 21/37 (55%), Gaps = 1/37 (2%) Query: 89 PEEIIFANDGYGGYYLLNTATDVVLFLDTDDGSKHAL 125 PE +IF N GY +LLNT D+ + D K+++ Sbjct: 14 PEILIFVN-GYPIKFLLNTGADITILNRRDFQVKNSI 49