>pdb|1GV1|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases pdb|1GV1|C Chain C, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases pdb|1GV1|D Chain D, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases pdb|1GV1|B Chain B, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Score = 28.1 bits (61), Expect = 1.6 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 306 GANDLDGTIEIESIQSAAGAKSRHGLEKEDLIFKIKDAGFVAVERDSL 353 G+ND T + + + AG + G+ +EDL+ +K+AG V D++ Sbjct: 60 GSNDYADTADSDIVIITAGLPRKPGMTREDLL--MKNAGIVKEVTDNI 105