>pdb|1HR6|A Chain A, Yeast Mitochondrial Processing Peptidase
 pdb|1HR6|G Chain G, Yeast Mitochondrial Processing Peptidase
 pdb|1HR7|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR6|E Chain E, Yeast Mitochondrial Processing Peptidase
 pdb|1HR6|C Chain C, Yeast Mitochondrial Processing Peptidase
 pdb|1HR8|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR9|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR9|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR7|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR7|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
 pdb|1HR8|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR8|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR9|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR9|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Malate Dehydrogenase Signal Peptide
 pdb|1HR8|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
           Complexed With Cytochrome C Oxidase Iv Signal Peptide
 pdb|1HR7|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant
          Length = 475

 Score = 26.2 bits (56), Expect = 0.66
 Identities = 12/31 (38%), Positives = 19/31 (60%)

Query: 20  LRHKGILFEKISKQFLQEHDSANEYESIDLW 50
           L  + + F KI++Q LQE   + EYE  ++W
Sbjct: 104 LMSETVRFPKITEQELQEQKLSAEYEIDEVW 134