>pdb|1HR6|A Chain A, Yeast Mitochondrial Processing Peptidase pdb|1HR6|G Chain G, Yeast Mitochondrial Processing Peptidase pdb|1HR7|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant pdb|1HR6|E Chain E, Yeast Mitochondrial Processing Peptidase pdb|1HR6|C Chain C, Yeast Mitochondrial Processing Peptidase pdb|1HR8|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide pdb|1HR9|A Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide pdb|1HR9|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide pdb|1HR7|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant pdb|1HR7|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant pdb|1HR8|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide pdb|1HR8|G Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide pdb|1HR9|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide pdb|1HR9|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide pdb|1HR8|E Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide pdb|1HR7|C Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Length = 475 Score = 26.2 bits (56), Expect = 0.66 Identities = 12/31 (38%), Positives = 19/31 (60%) Query: 20 LRHKGILFEKISKQFLQEHDSANEYESIDLW 50 L + + F KI++Q LQE + EYE ++W Sbjct: 104 LMSETVRFPKITEQELQEQKLSAEYEIDEVW 134