>pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
          Length = 678

 Score = 26.6 bits (57), Expect = 1.6
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%)

Query: 55  YSYYVWLVALIAALLSNLLFNPKGRSVGYLMIETW 89
           +SYYVWL     A+  NL  N  G    + ++E W
Sbjct: 89  FSYYVWL----EAMYGNLTGNWSGVETAWKVMEDW 119