>pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome Length = 678 Score = 26.6 bits (57), Expect = 1.6 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 55 YSYYVWLVALIAALLSNLLFNPKGRSVGYLMIETW 89 +SYYVWL A+ NL N G + ++E W Sbjct: 89 FSYYVWL----EAMYGNLTGNWSGVETAWKVMEDW 119