>pdb|1DIP|A Chain A, The Solution Structure Of Porcine Delta-Sleep-Inducing Peptide Immunoreactive Peptide, Nmr, 10 Structures pdb|1DIP|B Chain B, The Solution Structure Of Porcine Delta-Sleep-Inducing Peptide Immunoreactive Peptide, Nmr, 10 Structures Length = 78 Score = 29.3 bits (64), Expect = 0.24 Identities = 17/37 (45%), Positives = 23/37 (61%), Gaps = 3/37 (8%) Query: 8 QEQIKNLVEGNLDW---NTVLKMLSMPKDHERFQMYL 41 +EQI+ LVE N NT+LK L+ P+ E+FQ L Sbjct: 21 KEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSRL 57