>pdb|1FXO|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|E Chain E, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|F Chain F, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|G Chain G, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1G1L|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|F Chain F, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G0R|F Chain F, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1FZW|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|F Chain F, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1G3L|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-L-Rhamnose Complex. pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1FXO|H Chain H, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. pdb|1G1L|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|E Chain E, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|G Chain G, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G1L|H Chain H, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-Glucose Complex. pdb|1G0R|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|E Chain E, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|G Chain G, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1G0R|H Chain H, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). ThymidineGLUCOSE-1-Phosphate Complex. pdb|1FZW|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|E Chain E, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|G Chain G, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1FZW|H Chain H, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Apo Enzyme. pdb|1G2V|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|D Chain D, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|E Chain E, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|F Chain F, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|G Chain G, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G2V|H Chain H, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Ttp Complex. pdb|1G3L|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-L-Rhamnose Complex. pdb|1G3L|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-L-Rhamnose Complex. pdb|1G3L|C Chain C, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tdp-L-Rhamnose Complex Length = 293 Score = 25.0 bits (53), Expect = 2.7 Identities = 18/41 (43%), Positives = 23/41 (55%) Query: 17 FKALFYSKDGLKCAWIEESAFRQIVILALFCIVLASYLAKD 57 F A ++ GLK A EE A+RQ I A LA+ LAK+ Sbjct: 238 FIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKN 278