>pdb|1FXO|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|E Chain E, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|F Chain F, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|G Chain G, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1G1L|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|F Chain F, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G0R|F Chain F, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1FZW|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|F Chain F, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1G3L|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-L-Rhamnose Complex.
 pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1FXO|H Chain H, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tmp Complex.
 pdb|1G1L|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|E Chain E, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|G Chain G, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G1L|H Chain H, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-Glucose Complex.
 pdb|1G0R|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|E Chain E, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|G Chain G, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1G0R|H Chain H, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). ThymidineGLUCOSE-1-Phosphate Complex.
 pdb|1FZW|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|E Chain E, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|G Chain G, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1FZW|H Chain H, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Apo Enzyme.
 pdb|1G2V|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|D Chain D, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|E Chain E, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|F Chain F, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|G Chain G, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G2V|H Chain H, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Ttp Complex.
 pdb|1G3L|A Chain A, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-L-Rhamnose Complex.
 pdb|1G3L|B Chain B, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-L-Rhamnose Complex.
 pdb|1G3L|C Chain C, The Structural Basis Of The Catalytic Mechanism And
           Regulation Of Glucose-1-Phosphate Thymidylyltransferase
           (Rmla). Tdp-L-Rhamnose Complex
          Length = 293

 Score = 25.0 bits (53), Expect = 2.7
 Identities = 18/41 (43%), Positives = 23/41 (55%)

Query: 17  FKALFYSKDGLKCAWIEESAFRQIVILALFCIVLASYLAKD 57
           F A   ++ GLK A  EE A+RQ  I A     LA+ LAK+
Sbjct: 238 FIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKN 278