>pdb|1EZV|A Chain A, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment pdb|1KYO|A Chain A, Yeast Cytochrome Bc1 Complex With Bound Substrate Cytochrome C pdb|1KYO|L Chain L, Yeast Cytochrome Bc1 Complex With Bound Substrate Cytochrome C Length = 430 Score = 24.3 bits (51), Expect = 4.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 4 KELLEFNDYAMDLTIRMAHHSTAIENNPLSL 34 K++ +F D + HSTA +N PLSL Sbjct: 119 KQVQDFEDNDHPNRVLEHLHSTAFQNTPLSL 149