>pdb|1FJG|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotics Streptomycin,
           Spectinomycin And Paromomycin
 pdb|1J5E|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit
 pdb|1IBL|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site And With The Antibiotic Paromomycin
 pdb|1HR0|I Chain I, Crystal Structure Of Initiation Factor If1 Bound To The
           30s Ribosomal Subunit
 pdb|1HNZ|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Hygromycin B
 pdb|1IBM|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site
 pdb|1IBK|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotic Paromomycin
 pdb|1HNW|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Tetracycline
 pdb|1HNX|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Pactamycin
 pdb|1I94|I Chain I, Crystal Structures Of The Small Ribosomal Subunit With
           Tetracycline, Edeine And If3
 pdb|1I96|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With The Translation
           Initiation Factor If3 (C-Terminal Domain)
 pdb|1I97|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Tetracycline
 pdb|1I95|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Edeine
 pdb|1JGQ|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1GIX|L Chain L, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1gix, Contains The 30s Ribosome Subunit,
           Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
           In The File 1giy
 pdb|1JGO|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1JGP|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
          Length = 128

 Score =  116 bits (291), Expect = 7e-28
 Identities = 61/129 (47%), Positives = 85/129 (65%), Gaps = 1/129 (0%)

Query: 1   MRKIYATGKRKTAIAKVWLTPGKGELSINEQSLNQWLGGHEAIKMKVMQPLLLTKQEQSV 60
           M + Y TG+RK A+A+V+L PG G++++N Q  N++  G     +  ++PL         
Sbjct: 1   MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRA-VAALEPLRAVDALGRF 59

Query: 61  DIKAVVFGGGYSAQAEALRHGISKALNAYDIAFRAILKPKGLLTRDSRVVERKKYGKRKA 120
           D    V GGG S Q +A++ GI++AL  Y+  +RA LKP G LTRD+RVVERKKYGK KA
Sbjct: 60  DAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKA 119

Query: 121 RRSPQFSKR 129
           RR+PQ+SKR
Sbjct: 120 RRAPQYSKR 128