>pdb|3DAA|A Chain A, Crystallographic Structure Of D-Amino Acid Aminotransferase Inactivated By Pyridoxyl-D-Alanine pdb|3DAA|B Chain B, Crystallographic Structure Of D-Amino Acid Aminotransferase Inactivated By Pyridoxyl-D-Alanine pdb|4DAA|A Chain A, Crystallographic Structure Of D-Amino Acid Aminotransferase In Pyridoxal-5'-Phosphate (Plp) Form pdb|4DAA|B Chain B, Crystallographic Structure Of D-Amino Acid Aminotransferase In Pyridoxal-5'-Phosphate (Plp) Form Length = 277 Score = 26.9 bits (58), Expect = 2.8 Identities = 12/51 (23%), Positives = 24/51 (46%) Query: 230 KSDDFYTIGDKALDAIEISKCQMVLKKHSTDKLDSQHKAISIDLDFKKERF 280 K D Y GD + +++ +M D+L + + I I + + K++F Sbjct: 19 KEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYTKDKF 69