>pdb|1K8A|N Chain N, Co-Crystal Structure Of Carbomycin A Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1K9M|N Chain N, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1KD1|N Chain N, Co-Crystal Structure Of Spiramycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1M1K|N Chain N, Co-Crystal Structure Of Azithromycin Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui pdb|1M90|N Chain N, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And Sparsomycin Bound To The 50s Ribosomal Subunit pdb|1JJ2|L Chain L, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution pdb|1KQS|L Chain L, The Haloarcula Marismortui 50s Complexed With A Pretranslocational Intermediate In Protein Synthesis Length = 194 Score = 26.6 bits (57), Expect = 3.3 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 35 AKRYYKEVEKFAKNLTQLTQEEFMRLREPQKQVVIKNIGNMTRLHSKRAMDYIAKHGELV 94 A Y +E K K Q+ + + R++E + + + I TRL R++ Y AK G +V Sbjct: 4 AYSYIREAWKRPKE-GQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIV 62