BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645710|ref|NP_207887.1| IS605 transposase (tnpA)
[Helicobacter pylori 26695]
         (142 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1SUR|    Phospho-Adenylyl-Sulfate Reductase                    24  7.6
>pdb|1SUR|   Phospho-Adenylyl-Sulfate Reductase
          Length = 215

 Score = 23.9 bits (50), Expect = 7.6
 Identities = 10/34 (29%), Positives = 17/34 (49%), Gaps = 2/34 (5%)

Query: 97  WRDKRFIPLLQKHFWKEKTFWTDGFFVCSIGEAN 130
           W ++     LQKH  K    W +G+   S+G+ +
Sbjct: 184 WDNRTIYQYLQKHGLKYHPLWDEGYL--SVGDTH 215
  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.325    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 788,030
Number of Sequences: 13198
Number of extensions: 26824
Number of successful extensions: 89
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 1
length of query: 142
length of database: 2,899,336
effective HSP length: 79
effective length of query: 63
effective length of database: 1,856,694
effective search space: 116971722
effective search space used: 116971722
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)