BLASTP 2.2.1 [Apr-13-2001]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|15645710|ref|NP_207887.1| IS605 transposase (tnpA)
[Helicobacter pylori 26695]
(142 letters)
Database: /var/www/html/HP/blast_new/blast/db/pdbaa
13,198 sequences; 2,899,336 total letters
Searching...........................done
Score E
Sequences producing significant alignments: (bits) Value
pdb|1SUR| Phospho-Adenylyl-Sulfate Reductase 24 7.6
>pdb|1SUR| Phospho-Adenylyl-Sulfate Reductase
Length = 215
Score = 23.9 bits (50), Expect = 7.6
Identities = 10/34 (29%), Positives = 17/34 (49%), Gaps = 2/34 (5%)
Query: 97 WRDKRFIPLLQKHFWKEKTFWTDGFFVCSIGEAN 130
W ++ LQKH K W +G+ S+G+ +
Sbjct: 184 WDNRTIYQYLQKHGLKYHPLWDEGYL--SVGDTH 215
Database: /var/www/html/HP/blast_new/blast/db/pdbaa
Posted date: Dec 20, 2002 11:08 AM
Number of letters in database: 2,899,336
Number of sequences in database: 13,198
Lambda K H
0.325 0.139 0.425
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 788,030
Number of Sequences: 13198
Number of extensions: 26824
Number of successful extensions: 89
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 1
length of query: 142
length of database: 2,899,336
effective HSP length: 79
effective length of query: 63
effective length of database: 1,856,694
effective search space: 116971722
effective search space used: 116971722
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)