BLASTP 2.2.1 [Apr-13-2001]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= gi|15645777|ref|NP_207954.1| hypothetical protein
[Helicobacter pylori 26695]
(63 letters)
Database: /var/www/html/HP/blast_new/blast/db/pdbaa
13,198 sequences; 2,899,336 total letters
Searching...........................done
Score E
Sequences producing significant alignments: (bits) Value
pdb|1LNS|A Chain A, Crystal Structure Analysis Of The X-Pro... 23 4.9
>pdb|1LNS|A Chain A, Crystal Structure Analysis Of The X-Prolyl Dipeptidyl
Aminopeptidase From Lactococcus Lactis
Length = 763
Score = 23.5 bits (49), Expect = 4.9
Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 4/30 (13%)
Query: 22 IAFLWGVKSGQFDDEKRMLESVLYDSASDL 51
+ F W V F DEK++L+ L S SD+
Sbjct: 23 LGFRWSV----FWDEKKILKDFLIQSPSDM 48
Database: /var/www/html/HP/blast_new/blast/db/pdbaa
Posted date: Dec 20, 2002 11:08 AM
Number of letters in database: 2,899,336
Number of sequences in database: 13,198
Lambda K H
0.319 0.136 0.365
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 277,977
Number of Sequences: 13198
Number of extensions: 7318
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 15
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 2,899,336
effective HSP length: 39
effective length of query: 24
effective length of database: 2,384,614
effective search space: 57230736
effective search space used: 57230736
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)