BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645777|ref|NP_207954.1| hypothetical protein
[Helicobacter pylori 26695]
         (63 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1LNS|A  Chain A, Crystal Structure Analysis Of The X-Pro...    23  4.9
>pdb|1LNS|A Chain A, Crystal Structure Analysis Of The X-Prolyl Dipeptidyl
          Aminopeptidase From Lactococcus Lactis
          Length = 763

 Score = 23.5 bits (49), Expect = 4.9
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 4/30 (13%)

Query: 22 IAFLWGVKSGQFDDEKRMLESVLYDSASDL 51
          + F W V    F DEK++L+  L  S SD+
Sbjct: 23 LGFRWSV----FWDEKKILKDFLIQSPSDM 48
  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.319    0.136    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 277,977
Number of Sequences: 13198
Number of extensions: 7318
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 15
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 2,899,336
effective HSP length: 39
effective length of query: 24
effective length of database: 2,384,614
effective search space: 57230736
effective search space used: 57230736
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)