BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645944|ref|NP_208123.1| conserved hypothetical
integral membrane protein [Helicobacter pylori 26695]
         (228 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1QMY|A  Chain A, Fmdv Leader Protease (Lbshort-C51a-C133...    25  7.5
pdb|1QOL|C  Chain C, Structure Of The Fmdv Leader Protease >...    25  7.5
pdb|1RK2|B  Chain B, E. Coli Ribokinase Complexed With Ribos...    25  7.5

>pdb|1QMY|A Chain A, Fmdv Leader Protease (Lbshort-C51a-C133s)
 pdb|1QMY|B Chain B, Fmdv Leader Protease (Lbshort-C51a-C133s)
 pdb|1QMY|C Chain C, Fmdv Leader Protease (Lbshort-C51a-C133s)
          Length = 167

 Score = 25.0 bits (53), Expect = 7.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 179 YKRTTNHKNAWLGIVI 194
           Y R  NH NAWL  ++
Sbjct: 14  YSRPNNHDNAWLNAIL 29



>pdb|1QOL|C Chain C, Structure Of The Fmdv Leader Protease
 pdb|1QOL|D Chain D, Structure Of The Fmdv Leader Protease
 pdb|1QOL|G Chain G, Structure Of The Fmdv Leader Protease
 pdb|1QOL|H Chain H, Structure Of The Fmdv Leader Protease
 pdb|1QOL|A Chain A, Structure Of The Fmdv Leader Protease
 pdb|1QOL|B Chain B, Structure Of The Fmdv Leader Protease
 pdb|1QOL|E Chain E, Structure Of The Fmdv Leader Protease
 pdb|1QOL|F Chain F, Structure Of The Fmdv Leader Protease
          Length = 173

 Score = 25.0 bits (53), Expect = 7.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 179 YKRTTNHKNAWLGIVI 194
           Y R  NH NAWL  ++
Sbjct: 14  YSRPNNHDNAWLNAIL 29



>pdb|1RK2|B Chain B, E. Coli Ribokinase Complexed With Ribose And Adp, Solved
           In Space Group P212121
 pdb|1GQT|B Chain B, Activation Of Ribokinase By Monovalent Cations
 pdb|1RKD|   E. Coli Ribokinase Complexed With Ribose And Adp
 pdb|1RK2|C Chain C, E. Coli Ribokinase Complexed With Ribose And Adp, Solved
           In Space Group P212121
 pdb|1GQT|C Chain C, Activation Of Ribokinase By Monovalent Cations
 pdb|1RK2|A Chain A, E. Coli Ribokinase Complexed With Ribose And Adp, Solved
           In Space Group P212121
 pdb|1RK2|D Chain D, E. Coli Ribokinase Complexed With Ribose And Adp, Solved
           In Space Group P212121
 pdb|1RKA|A Chain A, The Apo Form Of E. Coli Ribokinase
 pdb|1GQT|A Chain A, Activation Of Ribokinase By Monovalent Cations
 pdb|1GQT|D Chain D, Activation Of Ribokinase By Monovalent Cations
 pdb|1RKS|A Chain A, E. Coli Ribokinase In Complex With D-Ribose
          Length = 309

 Score = 25.0 bits (53), Expect = 7.5
 Identities = 17/67 (25%), Positives = 31/67 (45%), Gaps = 12/67 (17%)

Query: 62  LLSAQASLMNVVIVSLLVNARQTCYALSMLDRFKNTKWRLPYLAHALTDETFALLNLYAP 121
           L+  ++ L +V+  + + +  +T  AL+            P  A  L DE  AL+++  P
Sbjct: 139 LMQLESPLESVMAAAKIAHQNKTIVALN------------PAPARELPDELLALVDIITP 186

Query: 122 KEGVSEK 128
            E  +EK
Sbjct: 187 NETEAEK 193



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.332    0.142    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,104,109
Number of Sequences: 13198
Number of extensions: 38693
Number of successful extensions: 92
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 90
Number of HSP's gapped (non-prelim): 3
length of query: 228
length of database: 2,899,336
effective HSP length: 85
effective length of query: 143
effective length of database: 1,777,506
effective search space: 254183358
effective search space used: 254183358
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 52 (24.6 bits)