BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645986|ref|NP_208167.1| (3R)-hydroxymyristoyl-(acyl
carrier protein) dehydratase (fabZ) [Helicobacter pylori 26695]
         (159 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1MKA|A  Chain A, E. Coli Beta-Hydroxydecanoyl Thiol Este...    29  0.22
pdb|1E9I|D  Chain D, Enolase From E.Coli >gi|16975437|pdb|1E...    25  5.5
pdb|1KV9|A  Chain A, Structure At 1.9 A Resolution Of A Quin...    24  7.1

>pdb|1MKA|A Chain A, E. Coli Beta-Hydroxydecanoyl Thiol Ester Dehydrase
          Modified By Its Classic Mechanism-Based Inactivator,
          3-Decynoyl-N-Acetyl Cysteamine
 pdb|1MKA|B Chain B, E. Coli Beta-Hydroxydecanoyl Thiol Ester Dehydrase
          Modified By Its Classic Mechanism-Based Inactivator,
          3-Decynoyl-N-Acetyl Cysteamine
 pdb|1MKB|A Chain A, Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester
          Dehydrase At Ph 5 And 21 Degrees C
 pdb|1MKB|B Chain B, Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester
          Dehydrase At Ph 5 And 21 Degrees C
          Length = 171

 Score = 29.3 bits (64), Expect = 0.22
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 27 MLLVDRIIELQAN----KKIVAYKNITFNEDV--FNGHFPNKPIFPGVLIVEGMAQTGGF 80
          ML++DR++++        K      +  N D+  F  HF   P+ PG L ++ M Q  GF
Sbjct: 33 MLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGF 92



>pdb|1E9I|D Chain D, Enolase From E.Coli
 pdb|1E9I|A Chain A, Enolase From E.Coli
 pdb|1E9I|B Chain B, Enolase From E.Coli
 pdb|1E9I|C Chain C, Enolase From E.Coli
          Length = 431

 Score = 24.6 bits (52), Expect = 5.5
 Identities = 17/43 (39%), Positives = 23/43 (52%), Gaps = 1/43 (2%)

Query: 116 GDRLEYHL-EVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAE 157
           G  + +HL +VLK KGM   VG        + + AE  A+IAE
Sbjct: 185 GSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAE 227



>pdb|1KV9|A Chain A, Structure At 1.9 A Resolution Of A Quinohemoprotein
           Alcohol Dehydrogenase From Pseudomonas Putida Hk5
          Length = 668

 Score = 24.3 bits (51), Expect = 7.1
 Identities = 8/12 (66%), Positives = 10/12 (82%)

Query: 86  LWGFDPEIAKTK 97
           LW +DPE+AK K
Sbjct: 89  LWRYDPEVAKVK 100



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.324    0.142    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 944,845
Number of Sequences: 13198
Number of extensions: 38783
Number of successful extensions: 85
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 83
Number of HSP's gapped (non-prelim): 3
length of query: 159
length of database: 2,899,336
effective HSP length: 81
effective length of query: 78
effective length of database: 1,830,298
effective search space: 142763244
effective search space used: 142763244
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)