BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644649|ref|NP_206818.1| hypothetical protein
[Helicobacter pylori 26695]
         (87 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1JB0|A  Chain A, Crystal Structure Of Photosystem I: A P...    24  3.2

>pdb|1JB0|A Chain A, Crystal Structure Of Photosystem I: A Photosynthetic
           Reaction Center And Core Antenna System From
           Cyanobacteria
          Length = 755

 Score = 23.9 bits (50), Expect = 3.2
 Identities = 16/60 (26%), Positives = 27/60 (44%)

Query: 20  FLWLNAKSYLISVFAPFILLPWIDLLSAFLLYLGFLALFSVLEFFDEDIADIIVAKSKIK 79
           FLW  A   + S  +       + L + F+     + LFS   ++ E I  I+ A +K+K
Sbjct: 653 FLWAQASQVIGSYGSALSAYGLLFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLK 712



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.330    0.144    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 383,407
Number of Sequences: 13198
Number of extensions: 11054
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 1
length of query: 87
length of database: 2,899,336
effective HSP length: 63
effective length of query: 24
effective length of database: 2,067,862
effective search space: 49628688
effective search space used: 49628688
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 46 (22.3 bits)