BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644877|ref|NP_207047.1| hypothetical protein
[Helicobacter pylori 26695]
         (179 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1ESW|A  Chain A, X-Ray Structure Of Acarbose Bound To Am...    27  1.8

>pdb|1ESW|A Chain A, X-Ray Structure Of Acarbose Bound To Amylomaltase From
           Thermus Aquaticus. Implications For The Synthesis Of
           Large Cyclic Glucans
 pdb|1CWY|A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus,
           A Glycosyltransferase Catalysing The Production Of Large
           Cyclic Glucans
          Length = 500

 Score = 26.6 bits (57), Expect = 1.8
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 131 HAFKWFVKKSYEKIFKEKILPKESKVFSFF 160
           +A+KW   K   + FKEK  P+E + F+ F
Sbjct: 101 YAWKWPALKEAFRGFKEKASPEEREAFAAF 130



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.329    0.141    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 819,661
Number of Sequences: 13198
Number of extensions: 26817
Number of successful extensions: 72
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 71
Number of HSP's gapped (non-prelim): 1
length of query: 179
length of database: 2,899,336
effective HSP length: 82
effective length of query: 97
effective length of database: 1,817,100
effective search space: 176258700
effective search space used: 176258700
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)