BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644941|ref|NP_207111.1| nitrite extrusion protein
(narK) [Helicobacter pylori 26695]
         (381 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1MDB|A  Chain A, Crystal Structure Of Dhbe In Complex Wi...    27  3.8

>pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-Adenylate
 pdb|1MDF|A Chain A, Crystal Structure Of Dhbe In Absence Of Substrate
          Length = 539

 Score = 26.9 bits (58), Expect = 3.8
 Identities = 15/42 (35%), Positives = 25/42 (58%)

Query: 292 LSIFIMGAATTANINLFSMMALKIAGAKHFAQASSWVVFSFG 333
           L++  M AA++   +L S+  L++ GAK  A+A+  V   FG
Sbjct: 282 LAMVWMDAASSRRDDLSSLQVLQVGGAKFSAEAARRVKAVFG 323



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.334    0.147    0.463 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,935,784
Number of Sequences: 13198
Number of extensions: 71507
Number of successful extensions: 245
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 244
Number of HSP's gapped (non-prelim): 1
length of query: 381
length of database: 2,899,336
effective HSP length: 90
effective length of query: 291
effective length of database: 1,711,516
effective search space: 498051156
effective search space used: 498051156
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 55 (25.8 bits)