BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644970|ref|NP_207140.1| hypothetical protein
[Helicobacter pylori 26695]
         (130 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1BHG|A  Chain A, Human Beta-Glucuronidase At 2.6 A Resol...    25  3.7

>pdb|1BHG|A Chain A, Human Beta-Glucuronidase At 2.6 A Resolution
 pdb|1BHG|B Chain B, Human Beta-Glucuronidase At 2.6 A Resolution
          Length = 613

 Score = 24.6 bits (52), Expect = 3.7
 Identities = 14/43 (32%), Positives = 20/43 (45%), Gaps = 4/43 (9%)

Query: 25  DKNSADQKMWRIPEKALWVLSLLGGSVGFLVAMVVSHHKILKP 67
           DKN     MW +  +    L     S G+ + MV++H K L P
Sbjct: 417 DKNHPAVVMWSVANEPASHLE----SAGYYLKMVIAHTKSLDP 455



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.328    0.143    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 675,890
Number of Sequences: 13198
Number of extensions: 21439
Number of successful extensions: 42
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 42
Number of HSP's gapped (non-prelim): 1
length of query: 130
length of database: 2,899,336
effective HSP length: 78
effective length of query: 52
effective length of database: 1,869,892
effective search space: 97234384
effective search space used: 97234384
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)