BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644697|ref|NP_206867.1| urease accessory protein
(ureH) [Helicobacter pylori 26695]
         (265 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1E79|G  Chain G, Bovine F1-Atpase Inhibited By Dccd (Dic...    25  7.0
pdb|1FPT|H  Chain H, Three-Dimensional Structure Of The Comp...    25  7.0

>pdb|1E79|G Chain G, Bovine F1-Atpase Inhibited By Dccd
           (Dicyclohexylcarbodiimide)
 pdb|1H8E|G Chain G, (Adp.Alf4)2(Adp.So4) Bovine F1-Atpase (All Three Catalytic
           Sites Occupied)
 pdb|1E1R|G Chain G, Bovine Mitochondrial F1-Atpase Inhibited By Mg2+adp And
           Aluminium Fluoride
 pdb|1E1Q|G Chain G, Bovine Mitochondrial F1-Atpase At 100k
 pdb|1BMF|G Chain G, Bovine Mitochondrial F1-Atpase
 pdb|1H8H|G Chain G, Bovine Mitochondrial F1-Atpase Crystallised In The
           Presence Of 5mm Amppnp
 pdb|1NBM|G Chain G, The Structure Of Bovine F1-Atpase Covalently Inhibited
           With 4-Chloro-7-Nitrobenzofurazan
 pdb|1EFR|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With The Peptide
           Antibiotic Efrapeptin
 pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B
 pdb|1QO1|G Chain G, Molecular Architecture Of The Rotary Motor In Atp Synthase
           From Yeast Mitochondria
          Length = 272

 Score = 25.4 bits (54), Expect = 7.0
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 155 FNRLHTKISILQDEKPIYYDNTILDPKTTDLNNMCMFDGYTHYLNLVLVN 204
           FNR  + IS   +EKPI+  +TI   ++  + +    D   +Y    L N
Sbjct: 162 FNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLAN 211



>pdb|1FPT|H Chain H, Three-Dimensional Structure Of The Complex Between The Fab
           Fragment Of An Neutralizing Antibody For Type 1
           Poliovirus And Its Viral Epitope
          Length = 220

 Score = 25.4 bits (54), Expect = 7.0
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 119 NAHFKGNTTISLRSSSQLLYSEI 141
           NA+FKG  T++   SS ++Y ++
Sbjct: 61  NANFKGKATLTADKSSSIVYMQL 83



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.320    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,501,852
Number of Sequences: 13198
Number of extensions: 60284
Number of successful extensions: 195
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 193
Number of HSP's gapped (non-prelim): 2
length of query: 265
length of database: 2,899,336
effective HSP length: 87
effective length of query: 178
effective length of database: 1,751,110
effective search space: 311697580
effective search space used: 311697580
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)