BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645317|ref|NP_207488.1| hypothetical protein
[Helicobacter pylori 26695]
         (257 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1DII|A  Chain A, Crystal Structure Of P-Cresol Methylhyd...    28  1.4

>pdb|1DII|A Chain A, Crystal Structure Of P-Cresol Methylhydroxylase At 2.5 A
           Resolution
 pdb|1DII|B Chain B, Crystal Structure Of P-Cresol Methylhydroxylase At 2.5 A
           Resolution
 pdb|1DIQ|A Chain A, Crystal Structure Of P-Cresol Methylhydroxylase With
           Substrate Bound
 pdb|1DIQ|B Chain B, Crystal Structure Of P-Cresol Methylhydroxylase With
           Substrate Bound
          Length = 521

 Score = 27.7 bits (60), Expect = 1.4
 Identities = 14/50 (28%), Positives = 21/50 (42%)

Query: 145 TGQDSLAAQTQRLIHKWGHDPQFYGWNTQLKNEFIFELHYQLLKKVPLLK 194
           TG   +       I KWG+ P   G  TQ       ++ + L+ K P+ K
Sbjct: 197 TGMGGVPGSNTWQIFKWGYGPTLDGMFTQANYGICTKMGFWLMPKPPVFK 246



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.324    0.141    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,664,165
Number of Sequences: 13198
Number of extensions: 71975
Number of successful extensions: 170
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 168
Number of HSP's gapped (non-prelim): 2
length of query: 257
length of database: 2,899,336
effective HSP length: 86
effective length of query: 171
effective length of database: 1,764,308
effective search space: 301696668
effective search space used: 301696668
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)