BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645342|ref|NP_207514.1| hypothetical protein
[Helicobacter pylori 26695]
         (53 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1B5D|A  Chain A, Dcmp Hydroxymethylase From T4 (Intact) ...    23  5.2

>pdb|1B5D|A Chain A, Dcmp Hydroxymethylase From T4 (Intact)
 pdb|1B5D|B Chain B, Dcmp Hydroxymethylase From T4 (Intact)
 pdb|1B5E|A Chain A, Dcmp Hydroxymethylase From T4
 pdb|1B5E|B Chain B, Dcmp Hydroxymethylase From T4
 pdb|1B49|A Chain A, Dcmp Hydroxymethylase From T4 (Phosphate-Bound)
 pdb|1B49|C Chain C, Dcmp Hydroxymethylase From T4 (Phosphate-Bound)
          Length = 246

 Score = 23.5 bits (49), Expect = 5.2
 Identities = 11/30 (36%), Positives = 15/30 (49%)

Query: 19 EEIKAKGLNVSVCSGDTRKVWCRAVKKKDE 48
          E  K+K L V    G+T K+W +    K E
Sbjct: 62 EWYKSKSLFVKDIPGETPKIWQQVASSKGE 91



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.310    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 302,731
Number of Sequences: 13198
Number of extensions: 8520
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 53
length of database: 2,899,336
effective HSP length: 29
effective length of query: 24
effective length of database: 2,516,594
effective search space: 60398256
effective search space used: 60398256
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 47 (22.7 bits)