BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644724|ref|NP_206894.1| conserved hypothetical
protein [Helicobacter pylori 26695]
         (155 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1BXY|A  Chain A, Crystal Structure Of Ribosomal Protein ...    24  6.8
pdb|1JZS|A  Chain A, Isoleucyl-Trna Synthetase Complexed Wit...    24  6.8

>pdb|1BXY|A Chain A, Crystal Structure Of Ribosomal Protein L30 From Thermus
           Thermophilus At 1.9 A Resolution: Conformational
           Flexibility Of The Molecule.
 pdb|1BXY|B Chain B, Crystal Structure Of Ribosomal Protein L30 From Thermus
           Thermophilus At 1.9 A Resolution: Conformational
           Flexibility Of The Molecule.
 pdb|1GIY|X Chain X, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
          Length = 60

 Score = 24.3 bits (51), Expect = 6.8
 Identities = 12/28 (42%), Positives = 16/28 (56%)

Query: 73  PKLVRDALKCMGFDRVSQEIVFEYEPKL 100
           PK  + ALK +G  R+ QE V E  P +
Sbjct: 16  PKDQKAALKALGLRRLQQERVLEDTPAI 43



>pdb|1JZS|A Chain A, Isoleucyl-Trna Synthetase Complexed With Mupirocin
 pdb|1ILE|   Isoleucyl-Trna Synthetase
 pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl-
           Adenylate Analogue
          Length = 821

 Score = 24.3 bits (51), Expect = 6.8
 Identities = 16/65 (24%), Positives = 26/65 (39%)

Query: 74  KLVRDALKCMGFDRVSQEIVFEYEPKLLKPSRLTYFFGYFQDPRYFDAISPLIKQTFTLP 133
           K   DAL+   +     E    + P L++ +   YF   +    +F   + L +     P
Sbjct: 608 KFGADALRWYIYVSAPPEADRRFGPNLVRETVRDYFLTLWNVYSFFVTYANLDRPDLKNP 667

Query: 134 PPPPK 138
           PPP K
Sbjct: 668 PPPEK 672



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.326    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 854,011
Number of Sequences: 13198
Number of extensions: 31130
Number of successful extensions: 120
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 118
Number of HSP's gapped (non-prelim): 2
length of query: 155
length of database: 2,899,336
effective HSP length: 81
effective length of query: 74
effective length of database: 1,830,298
effective search space: 135442052
effective search space used: 135442052
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)