BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645562|ref|NP_207738.1| conserved hypothetical
integral membrane protein [Helicobacter pylori 26695]
         (496 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1CTT|    Cytidine Deaminase (Cda) (E.C.3.5.4.5) Complexe...    28  2.4

>pdb|1CTT|   Cytidine Deaminase (Cda) (E.C.3.5.4.5) Complexed With
           3,4-Dihydrozebularine (Dhz)
 pdb|1AF2|A Chain A, Crystal Structure Of Cytidine Deaminase Complexed With
           Uridine
 pdb|1ALN|   Crystal Structure Of Cytidine Deaminase Complexed With
           3-Deazacytidine
 pdb|1CTU|   Cytidine Deaminase (Cda) (E.C.3.5.4.5) Complexed With 3,4 Hydrated
           Pyrimidine-2-One Riboside (Zeb)
          Length = 294

 Score = 28.1 bits (61), Expect = 2.4
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 125 IFVDDYFNALTVGQISKSLNDAHNSTRERLAYIIDSTSAPVCLLVPISSW--GAYIMGI 181
           I  D YF AL  G+   SL  A     + LA+ +   +A  C   P+S++  GA   G+
Sbjct: 23  ILADKYFPALLTGEQVSSLKSATGLDEDALAFALLPLAA-ACARTPLSNFNVGAIARGV 80



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.325    0.140    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,490,493
Number of Sequences: 13198
Number of extensions: 97616
Number of successful extensions: 187
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 187
Number of HSP's gapped (non-prelim): 1
length of query: 496
length of database: 2,899,336
effective HSP length: 92
effective length of query: 404
effective length of database: 1,685,120
effective search space: 680788480
effective search space used: 680788480
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 56 (26.2 bits)