BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645575|ref|NP_207751.1| conserved hypothetical
protein [Helicobacter pylori 26695]
         (243 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|12AS|A  Chain A, Asparagine Synthetase Mutant C51a, C315...    25  6.2

>pdb|12AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Complexed With
           L-Asparagine And Amp
 pdb|12AS|B Chain B, Asparagine Synthetase Mutant C51a, C315a Complexed With
           L-Asparagine And Amp
 pdb|11AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Complexed With
           L-Asparagine
 pdb|11AS|B Chain B, Asparagine Synthetase Mutant C51a, C315a Complexed With
           L-Asparagine
          Length = 330

 Score = 25.4 bits (54), Expect = 6.2
 Identities = 14/46 (30%), Positives = 24/46 (51%), Gaps = 2/46 (4%)

Query: 167 VCGSGASMFSSLKAQSCLITGDVKYHDAMIAQSLGIS--LIDATHY 210
           V G G   FS+LK+    I   +K  +A +++  G++  L D  H+
Sbjct: 122 VMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHF 167



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.320    0.136    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,289,310
Number of Sequences: 13198
Number of extensions: 47801
Number of successful extensions: 91
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 1
length of query: 243
length of database: 2,899,336
effective HSP length: 86
effective length of query: 157
effective length of database: 1,764,308
effective search space: 276996356
effective search space used: 276996356
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)