BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645590|ref|NP_207766.1| Glu-tRNA(Gln)
amidotransferase, subunit C (gatC) [Helicobacter pylori 26695]
         (93 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1KOR|B  Chain B, Crystal Structure Of Thermus Thermophil...    23  4.1
pdb|1HO8|A  Chain A, Crystal Structure Of The Regulatory Sub...    23  6.9

>pdb|1KOR|B Chain B, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Inhibitors
 pdb|1KOR|C Chain C, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Inhibitors
 pdb|1KOR|D Chain D, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Inhibitors
 pdb|1KH1|C Chain C, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase
 pdb|1KH2|C Chain C, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Atp
 pdb|1KH1|D Chain D, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase
 pdb|1KH2|D Chain D, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Atp
 pdb|1KH1|B Chain B, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase
 pdb|1KH2|B Chain B, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Atp
 pdb|1KOR|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Inhibitors
 pdb|1KH1|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase
 pdb|1KH2|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8
           Argininosuccinate Synthetase In Complex With Atp
          Length = 400

 Score = 23.5 bits (49), Expect = 4.1
 Identities = 15/46 (32%), Positives = 21/46 (45%)

Query: 16  MLEIKDEHKESVKGHLAEVLGFVENIFALETSALKTDIELCTPLRE 61
           ++ I +E       H A   G  +  F L   ALK DI++  P RE
Sbjct: 99  LVRIAEEEGAEAIAHGATGKGNDQVRFELTAYALKPDIKVIAPWRE 144



>pdb|1HO8|A Chain A, Crystal Structure Of The Regulatory Subunit H Of The
           V-Type Atpase Of Saccharomyces Cerevisiae
          Length = 480

 Score = 22.7 bits (47), Expect = 6.9
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 55  LCTPLREDEPKSQPNTAKEILSQNKHSQD 83
           L T   ED  KS  N   E+LS +K+  D
Sbjct: 86  LSTSDNEDCKKSVQNLIAELLSSDKYGDD 114



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.314    0.132    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 459,272
Number of Sequences: 13198
Number of extensions: 13785
Number of successful extensions: 24
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 22
Number of HSP's gapped (non-prelim): 2
length of query: 93
length of database: 2,899,336
effective HSP length: 69
effective length of query: 24
effective length of database: 1,988,674
effective search space: 47728176
effective search space used: 47728176
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)