BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645595|ref|NP_207771.1| conserved hypothetical
secreted protein [Helicobacter pylori 26695]
         (100 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1IPB|A  Chain A, Crystal Structure Of Eukaryotic Initiat...    24  2.3
pdb|2LKF|A  Chain A, Leukocidin F (Hlgb) From Staphylococcus...    24  2.3
pdb|1BQQ|M  Chain M, Crystal Structure Of The Mt1-Mmp--Timp-...    22  8.6

>pdb|1IPB|A Chain A, Crystal Structure Of Eukaryotic Initiation Factor 4e
          Complexed With 7-Methyl Gpppa
 pdb|1IPC|A Chain A, Crystal Structure Of Eukaryotic Initiation Factor 4e
          Complexed With 7-Methyl Gtp
          Length = 217

 Score = 24.3 bits (51), Expect = 2.3
 Identities = 10/29 (34%), Positives = 15/29 (51%)

Query: 71 KEENEENKTHQANDSYVQKNPFQKLWILF 99
          +EE  E+    AN  +  K+P Q  W L+
Sbjct: 18 EEEKTESNQEVANPEHYIKHPLQNRWALW 46



>pdb|2LKF|A Chain A, Leukocidin F (Hlgb) From Staphylococcus Aureus
 pdb|3LKF|A Chain A, Leukocidin F (Hlgb) From Staphylococcus Aureus With
          Phosphocholine Bound
 pdb|1LKF|A Chain A, Leukocidin F (Hlgb) From Staphylococcus Aureus
          Length = 299

 Score = 24.3 bits (51), Expect = 2.3
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 52 QFALSLIPLGGYVKLKGMDKEENEENKTHQANDSYVQKNP----FQKLW 96
          +F +S I    ++K K  DK+      T   N  +V+ NP    F KL+
Sbjct: 29 KFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLY 77



>pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex
 pdb|1BUV|M Chain M, Crystal Structure Of The Mt1-Mmp-Timp-2 Complex
          Length = 174

 Score = 22.3 bits (46), Expect = 8.6
 Identities = 8/10 (80%), Positives = 9/10 (90%)

Query: 12  FLIFVHELGH 21
           FL+ VHELGH
Sbjct: 121 FLVAVHELGH 130



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.330    0.146    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 547,869
Number of Sequences: 13198
Number of extensions: 19044
Number of successful extensions: 58
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 55
Number of HSP's gapped (non-prelim): 3
length of query: 100
length of database: 2,899,336
effective HSP length: 76
effective length of query: 24
effective length of database: 1,896,288
effective search space: 45510912
effective search space used: 45510912
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 46 (22.3 bits)