BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645597|ref|NP_207773.1| hypothetical protein
[Helicobacter pylori 26695]
         (231 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|2OCC|B  Chain B, Bovine Heart Cytochrome C Oxidase At Th...    25  9.9

>pdb|2OCC|B Chain B, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|2OCC|O Chain O, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 pdb|1OCR|B Chain B, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|1OCR|O Chain O, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 pdb|1OCO|B Chain B, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound
           State
 pdb|1OCO|O Chain O, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound
           State
 pdb|1OCC|B Chain B, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 pdb|1OCC|O Chain O, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 pdb|1OCZ|B Chain B, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 pdb|1OCZ|O Chain O, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
          Length = 227

 Score = 24.6 bits (52), Expect = 9.9
 Identities = 14/65 (21%), Positives = 34/65 (51%), Gaps = 2/65 (3%)

Query: 97  ANQDDTIFTLV--FIVIVVAIIALIAIFIRSILLNTIFVGSLIGSLWLYMVGFYYFYGVP 154
           A + +TI+T++   I+I++A+ +L  +++   + N       +G  W +   +  +  + 
Sbjct: 58  AQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLS 117

Query: 155 FLSYL 159
           F SY+
Sbjct: 118 FDSYM 122



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.331    0.145    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,149,345
Number of Sequences: 13198
Number of extensions: 41720
Number of successful extensions: 94
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 94
Number of HSP's gapped (non-prelim): 1
length of query: 231
length of database: 2,899,336
effective HSP length: 85
effective length of query: 146
effective length of database: 1,777,506
effective search space: 259515876
effective search space used: 259515876
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 52 (24.6 bits)